SCOPe 2.08: Domain d5v2cj_: 5v2c J:

Lineage for d5v2cj_ (5v2c J:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families)
   automatically mapped to Pfam PF01788

5. Family f.23.32.1: PsbJ-like [161022] (2 proteins)
   Pfam PF01788

6. Protein automated matches [191002] (3 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (25 PDB entries)

8. Domain d5v2cj_: 5v2c J: [338712]
   Other proteins in same PDB: d5v2ca_, d5v2cb_, d5v2cc_, d5v2cd_, d5v2ce_, d5v2cf_, d5v2ch_, d5v2ci_, d5v2ck_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2ct_, d5v2cu_, d5v2cv_, d5v2cx_, d5v2cz_
   automated match to d4ub8j_
   complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pe8, pg4, pge, pho, pl9, sqd

Details for d5v2cj_

PDB Entry: 5v2c, 1.9 Å

PDB Description: re-refinement of crystal structure of photosystem ii complex

PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d5v2cj_:

Sequence; same for both SEQRES and ATOM records:

>d5v2cj_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
eseggriplwivatvagmgvivivglffygayaglgssl

Timeline for d5v2cj_:

• d5v2cj_ first appeared in SCOPe 2.06
  
• d5v2cj_ appears in SCOPe 2.07