SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n28b1 (5n28 B:2-188)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2177144Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2177239Family d.58.31.0: automated matches [227271] (1 protein)
    not a true family
  6. 2177240Protein automated matches [227074] (4 species)
    not a true protein
  7. 2292072Species Methanotorris formicicus [TaxId:647171] [335373] (2 PDB entries)
  8. 2292133Domain d5n28b1: 5n28 B:2-188 [335434]
    Other proteins in same PDB: d5n28b2, d5n28e2
    automated match to d1hbnb2
    complexed with com, f43, k, tp7

Details for d5n28b1

PDB Entry: 5n28 (more details)

PDB Description: methyl-coenzyme m reductase iii from methanotorris formicicus monoclinic form
PDB Compounds: (B:) Methyl-coenzyme M reductase, beta subunit

SCOPe Domain Sequences for d5n28b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n28b1 d.58.31.0 (B:2-188) automated matches {Methanotorris formicicus [TaxId: 647171]}
vkyedkiclynakgelveenvpleaisplynptiqklvkdikrtvavnlagienalktga
vggkacvipgrtldlpivenaetimeyvdkllrispdddtsvklindgkqmavqlpskrl
evaaeysismlntamalkeaiiktfdvdmfdapmvhaailgrypqvpdymganiasllga
ptnlegl

SCOPe Domain Coordinates for d5n28b1:

Click to download the PDB-style file with coordinates for d5n28b1.
(The format of our PDB-style files is described here.)

Timeline for d5n28b1:

  • d5n28b1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15