SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n28f_ (5n28 F:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2177144Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2177239Family d.58.31.0: automated matches [227271] (1 protein)
    not a true family
  6. 2177240Protein automated matches [227074] (4 species)
    not a true protein
  7. 2292072Species Methanotorris formicicus [TaxId:647171] [335373] (2 PDB entries)
  8. 2292073Domain d5n28f_: 5n28 F: [335374]
    Other proteins in same PDB: d5n28b2, d5n28e2
    automated match to d1e6yc_
    complexed with com, f43, k, tp7

Details for d5n28f_

PDB Entry: 5n28 (more details)

PDB Description: methyl-coenzyme m reductase iii from methanotorris formicicus monoclinic form
PDB Compounds: (F:) Methyl-coenzyme M reductase, gamma subunit

SCOPe Domain Sequences for d5n28f_:

Sequence, based on SEQRES records: (download)

>d5n28f_ d.58.31.0 (F:) automated matches {Methanotorris formicicus [TaxId: 647171]}
ykpqfypgetkiaqnrrnhmnpeveleklreipdedvvkimghrqpgedyktihppleem
dlpddyvrdlvepingakeghriryiqfadsmyfapaqpydrartymwrfrgvdtgtlsg
rqviemresdlealsknflidtaffdparcgirgatvhghslrldenglmfdalqryvyd
ektghvvyvkdqvgrpldepvdvgellpeeklreittiyrkdgvpmredkelltivkrih
rartlggfcptedtfkql

Sequence, based on observed residues (ATOM records): (download)

>d5n28f_ d.58.31.0 (F:) automated matches {Methanotorris formicicus [TaxId: 647171]}
ykpqfypgetkiaqnrrnhmnpeveleklreipdedvvkimghrqpgedyktihppleem
dlpddyvrdlvepingakeghriryiqfadsmyfapaqpydrartymwrfrgvdtgtlsg
rqviemresdlealsknflidtaffdparcgirgatvhghslrldenglmfdalqryvhv
vyvkdqvgrpldepvdvgellpeeklreittiyrkdgvpmredkelltivkrihrartlg
gfcptedtfkql

SCOPe Domain Coordinates for d5n28f_:

Click to download the PDB-style file with coordinates for d5n28f_.
(The format of our PDB-style files is described here.)

Timeline for d5n28f_:

  • d5n28f_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15