SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n28e2 (5n28 E:189-444)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002224Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2002225Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2002287Family a.89.1.0: automated matches [227272] (1 protein)
    not a true family
  6. 2002288Protein automated matches [227075] (3 species)
    not a true protein
  7. 2292115Species Methanotorris formicicus [TaxId:647171] [335416] (1 PDB entry)
  8. 2292116Domain d5n28e2: 5n28 E:189-444 [335417]
    Other proteins in same PDB: d5n28b1, d5n28c_, d5n28e1, d5n28f_
    automated match to d1hbnb1

Details for d5n28e2

PDB Entry: 5n28 (more details)

PDB Description: methyl-coenzyme m reductase iii from methanotorris formicicus monoclinic form
PDB Compounds: (E:) Methyl-coenzyme M reductase, beta subunit

SCOPe Domain Sequences for d5n28e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n28e2 a.89.1.0 (E:189-444) automated matches {Methanotorris formicicus [TaxId: 647171]}
gyalrnimvnhyvattkknimnavafasimeqtamfemgdaigsferlhllglayqglna
dnlvidlvkangkngtvgtvvasiveraledgvitedkkmpsgfvlykpvdvakwnayaa
aglvaavivncgaaraaqnvastilyyndiieyetglpgvdfgraegtavgfsffshsiy
ggggpgifngnhivtrhskgfaippvcaamcvdagtqmfspektsalvgavfsaidefre
plkyvidgalavkdki

SCOPe Domain Coordinates for d5n28e2:

Click to download the PDB-style file with coordinates for d5n28e2.
(The format of our PDB-style files is described here.)

Timeline for d5n28e2:

  • d5n28e2 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15