Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins) C-terminal domain is all-alpha |
Protein Beta chain [55099] (3 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (11 PDB entries) |
Domain d1hbnb2: 1hbn B:2-188 [60901] Other proteins in same PDB: d1hbna1, d1hbna2, d1hbnb1, d1hbnc_, d1hbnd1, d1hbnd2, d1hbne1, d1hbnf_ complexed with cl, com, f43, gol, mg, na, tp7, zn |
PDB Entry: 1hbn (more details), 1.16 Å
SCOPe Domain Sequences for d1hbnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hbnb2 d.58.31.2 (B:2-188) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]} akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi pqklegp
Timeline for d1hbnb2: