Lineage for d5u16g2 (5u16 G:111-200)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749668Protein T-cell antigen receptor [49125] (7 species)
  7. 2749669Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)
  8. 2749679Domain d5u16g2: 5u16 G:111-200 [329866]
    Other proteins in same PDB: d5u16a1, d5u16a2, d5u16a3, d5u16b_, d5u16c1, d5u16c2, d5u16d_, d5u16e1, d5u16f1, d5u16f2, d5u16g1, d5u16h1, d5u16h2
    automated match to d2f54d2
    complexed with 7wo, cl, gol, na

    missing some secondary structures that made up less than one-third of the common domain

Details for d5u16g2

PDB Entry: 5u16 (more details), 2 Å

PDB Description: structure of human mr1-2-oh-1-na in complex with human mait a-f7 tcr
PDB Compounds: (G:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d5u16g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u16g2 b.1.1.2 (G:111-200) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d5u16g2:

Click to download the PDB-style file with coordinates for d5u16g2.
(The format of our PDB-style files is described here.)

Timeline for d5u16g2: