Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (7 species) |
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries) |
Domain d5u16g2: 5u16 G:111-200 [329866] Other proteins in same PDB: d5u16a1, d5u16a2, d5u16a3, d5u16b_, d5u16c1, d5u16c2, d5u16d_, d5u16e1, d5u16f1, d5u16f2, d5u16g1, d5u16h1, d5u16h2 automated match to d2f54d2 complexed with 7wo, cl, gol, na missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 5u16 (more details), 2 Å
SCOPe Domain Sequences for d5u16g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u16g2 b.1.1.2 (G:111-200) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffpsp
Timeline for d5u16g2: