Lineage for d5u16e1 (5u16 E:1-110)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (919 PDB entries)
  8. 2286666Domain d5u16e1: 5u16 E:1-110 [329967]
    Other proteins in same PDB: d5u16a1, d5u16a3, d5u16b_, d5u16c1, d5u16d_, d5u16e2, d5u16g2
    automated match to d2f54d1
    complexed with 7wo, cl, gol, na

Details for d5u16e1

PDB Entry: 5u16 (more details), 2 Å

PDB Description: structure of human mr1-2-oh-1-na in complex with human mait a-f7 tcr
PDB Compounds: (E:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d5u16e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u16e1 b.1.1.0 (E:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrf
ssflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd

SCOPe Domain Coordinates for d5u16e1:

Click to download the PDB-style file with coordinates for d5u16e1.
(The format of our PDB-style files is described here.)

Timeline for d5u16e1:

  • d5u16e1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-16