Lineage for d5lqbl2 (5lqb L:112-217)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (491 PDB entries)
  8. 2283934Domain d5lqbl2: 5lqb L:112-217 [327235]
    Other proteins in same PDB: d5lqba_, d5lqbl1
    automated match to d1tqbc2
    mutant

Details for d5lqbl2

PDB Entry: 5lqb (more details), 1.95 Å

PDB Description: complex structure of human il2 mutant, proleukin, with fab fragment of nara1 antibody
PDB Compounds: (L:) anti-hIL2 FAB fragment light chain

SCOPe Domain Sequences for d5lqbl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lqbl2 b.1.1.2 (L:112-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d5lqbl2:

Click to download the PDB-style file with coordinates for d5lqbl2.
(The format of our PDB-style files is described here.)

Timeline for d5lqbl2:

  • d5lqbl2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5lqbl1
View in 3D
Domains from other chains:
(mouse over for more information)
d5lqba_