SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lqbl2 (5lqb L:112-217)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (489 PDB entries)
  8. 2283934Domain d5lqbl2: 5lqb L:112-217 [327235]
    Other proteins in same PDB: d5lqba_, d5lqbl1
    automated match to d1tqbc2
    mutant

Details for d5lqbl2

PDB Entry: 5lqb (more details), 1.95 Å

PDB Description: complex structure of human il2 mutant, proleukin, with fab fragment of nara1 antibody
PDB Compounds: (L:) anti-hIL2 FAB fragment light chain

SCOPe Domain Sequences for d5lqbl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lqbl2 b.1.1.2 (L:112-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d5lqbl2:

Click to download the PDB-style file with coordinates for d5lqbl2.
(The format of our PDB-style files is described here.)

Timeline for d5lqbl2:

  • d5lqbl2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5lqbl1
View in 3D
Domains from other chains:
(mouse over for more information)
d5lqba_