![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 protein domains) |
![]() | Protein automated matches [190501] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187448] (20 PDB entries) |
![]() | Domain d5lqba_: 5lqb A: [327233] Other proteins in same PDB: d5lqbl1, d5lqbl2 automated match to d1irla_ mutant |
PDB Entry: 5lqb (more details), 1.95 Å
SCOPe Domain Sequences for d5lqba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lqba_ a.26.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp leevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwitfs qsiistlt
Timeline for d5lqba_: