Lineage for d5lqba_ (5lqb A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991436Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1991437Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1991528Family a.26.1.2: Short-chain cytokines [47286] (14 protein domains)
  6. 1991681Protein automated matches [190501] (4 species)
    not a true protein
  7. 1991682Species Human (Homo sapiens) [TaxId:9606] [187448] (17 PDB entries)
  8. 2283932Domain d5lqba_: 5lqb A: [327233]
    Other proteins in same PDB: d5lqbl1, d5lqbl2
    automated match to d1irla_
    mutant

Details for d5lqba_

PDB Entry: 5lqb (more details), 1.95 Å

PDB Description: complex structure of human il2 mutant, proleukin, with fab fragment of nara1 antibody
PDB Compounds: (A:) interleukin-2

SCOPe Domain Sequences for d5lqba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lqba_ a.26.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp
leevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwitfs
qsiistlt

SCOPe Domain Coordinates for d5lqba_:

Click to download the PDB-style file with coordinates for d5lqba_.
(The format of our PDB-style files is described here.)

Timeline for d5lqba_:

  • d5lqba_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15