SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lqba_ (5lqb A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991436Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1991437Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1991528Family a.26.1.2: Short-chain cytokines [47286] (14 protein domains)
  6. 1991681Protein automated matches [190501] (4 species)
    not a true protein
  7. 1991682Species Human (Homo sapiens) [TaxId:9606] [187448] (15 PDB entries)
  8. 2283932Domain d5lqba_: 5lqb A: [327233]
    Other proteins in same PDB: d5lqbl1, d5lqbl2
    automated match to d1irla_
    mutant

Details for d5lqba_

PDB Entry: 5lqb (more details), 1.95 Å

PDB Description: complex structure of human il2 mutant, proleukin, with fab fragment of nara1 antibody
PDB Compounds: (A:) interleukin-2

SCOPe Domain Sequences for d5lqba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lqba_ a.26.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp
leevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwitfs
qsiistlt

SCOPe Domain Coordinates for d5lqba_:

Click to download the PDB-style file with coordinates for d5lqba_.
(The format of our PDB-style files is described here.)

Timeline for d5lqba_:

  • d5lqba_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15