Lineage for d5lqbh1 (5lqb H:9-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744550Domain d5lqbh1: 5lqb H:9-219 [410374]
    Other proteins in same PDB: d5lqba_, d5lqbh2, d5lqbl1, d5lqbl2
    automated match to d6shgh_
    mutant

Details for d5lqbh1

PDB Entry: 5lqb (more details), 1.95 Å

PDB Description: complex structure of human il2 mutant, proleukin, with fab fragment of nara1 antibody
PDB Compounds: (H:) anti-hIL2 FAB fragment heavy chain

SCOPe Domain Sequences for d5lqbh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lqbh1 b.1.1.1 (H:9-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aelvrpgtsvkvsckasgyaftnyliewvkqrpgqglewigvinpgsggtnynekfkgka
tltadkssstaymqlssltsddsavyfcarwrgdgyyayfdvwgagttvtvssakttaps
vyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsss
vtvtsstwpsqsitcnvahpasstkvdkkie

SCOPe Domain Coordinates for d5lqbh1:

Click to download the PDB-style file with coordinates for d5lqbh1.
(The format of our PDB-style files is described here.)

Timeline for d5lqbh1:

  • d5lqbh1 is new in SCOPe 2.08-stable