SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ixaa2 (5ixa A:136-270)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2193533Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2193534Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2193719Family d.131.1.2: DNA polymerase processivity factor [55983] (5 protein domains)
    duplication: consists of two domains of this fold
  6. 2193861Protein UL44 [111176] (2 species)
  7. 2283337Species Human cytomegalovirus (strain ad169) [TaxId:10360] [326638] (2 PDB entries)
  8. 2283346Domain d5ixaa2: 5ixa A:136-270 [326647]
    automated match to d1t6la2

Details for d5ixaa2

PDB Entry: 5ixa (more details), 2.68 Å

PDB Description: hcmv dna polymerase processivity subunit ul44 at neutral ph and low salt
PDB Compounds: (A:) DNA polymerase processivity factor

SCOPe Domain Sequences for d5ixaa2:

Sequence, based on SEQRES records: (download)

>d5ixaa2 d.131.1.2 (A:136-270) UL44 {Human cytomegalovirus (strain ad169) [TaxId: 10360]}
vresensavhvdldfgvvadllkwigphtrvkrnvkkapcptgtvqilvhagppaikfil
tngseleftsnnrvsfhgvknmrinvqlknfyqtllncavtklpctlrivtehdtllyva
srnglfavenfltee

Sequence, based on observed residues (ATOM records): (download)

>d5ixaa2 d.131.1.2 (A:136-270) UL44 {Human cytomegalovirus (strain ad169) [TaxId: 10360]}
vresensavhvdldfgvvadllkwigphtgtvqilvhagppaikfiltngseleftsnnr
vsfhgvknmrinvqlknfyqtllncavtklpctlrivtehdtllyvasrnglfavenflt
ee

SCOPe Domain Coordinates for d5ixaa2:

Click to download the PDB-style file with coordinates for d5ixaa2.
(The format of our PDB-style files is described here.)

Timeline for d5ixaa2:

  • d5ixaa2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5ixaa1