Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
Protein UL44 [111176] (2 species) |
Species Human cytomegalovirus (strain ad169) [TaxId:10360] [326638] (2 PDB entries) |
Domain d5ixab2: 5ixa B:136-272 [326640] automated match to d1t6la2 |
PDB Entry: 5ixa (more details), 2.68 Å
SCOPe Domain Sequences for d5ixab2:
Sequence, based on SEQRES records: (download)
>d5ixab2 d.131.1.2 (B:136-272) UL44 {Human cytomegalovirus (strain ad169) [TaxId: 10360]} vresensavhvdldfgvvadllkwigphtrvkrnvkkapcptgtvqilvhagppaikfil tngseleftsnnrvsfhgvknmrinvqlknfyqtllncavtklpctlrivtehdtllyva srnglfavenflteepf
>d5ixab2 d.131.1.2 (B:136-272) UL44 {Human cytomegalovirus (strain ad169) [TaxId: 10360]} vresensavhvdldfgvvadllkwigptgtvqilvhagppaikfiltngseleftsnnrv sfhgvknmrinvqlknfyqtllncavtklpctlrivtehdtllyvasrnglfavenflte epf
Timeline for d5ixab2: