Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
Protein UL44 [111176] (2 species) |
Species Human cytomegalovirus (strain ad169) [TaxId:10360] [326638] (2 PDB entries) |
Domain d5ixab1: 5ixa B:8-135 [326639] automated match to d1t6la1 |
PDB Entry: 5ixa (more details), 2.68 Å
SCOPe Domain Sequences for d5ixab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ixab1 d.131.1.2 (B:8-135) UL44 {Human cytomegalovirus (strain ad169) [TaxId: 10360]} sepptlalrlkpyktaiqqlrsviralkenttvtflptpslilqtvrshcvskitfnssc lyitdksfqpktinnstpllgnfmyltsskdltkfyvqdisdlsakismcapdfnmefss acvhgqdi
Timeline for d5ixab1: