Lineage for d5ixab1 (5ixa B:8-135)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977007Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2977186Protein UL44 [111176] (2 species)
  7. 2977187Species Human cytomegalovirus (strain ad169) [TaxId:10360] [326638] (2 PDB entries)
  8. 2977192Domain d5ixab1: 5ixa B:8-135 [326639]
    automated match to d1t6la1

Details for d5ixab1

PDB Entry: 5ixa (more details), 2.68 Å

PDB Description: hcmv dna polymerase processivity subunit ul44 at neutral ph and low salt
PDB Compounds: (B:) DNA polymerase processivity factor

SCOPe Domain Sequences for d5ixab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ixab1 d.131.1.2 (B:8-135) UL44 {Human cytomegalovirus (strain ad169) [TaxId: 10360]}
sepptlalrlkpyktaiqqlrsviralkenttvtflptpslilqtvrshcvskitfnssc
lyitdksfqpktinnstpllgnfmyltsskdltkfyvqdisdlsakismcapdfnmefss
acvhgqdi

SCOPe Domain Coordinates for d5ixab1:

Click to download the PDB-style file with coordinates for d5ixab1.
(The format of our PDB-style files is described here.)

Timeline for d5ixab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ixab2