Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) |
Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species) |
Species Thermosynechococcus elongatus [TaxId:146786] [161048] (7 PDB entries) Uniprot Q8DIP0 3-84 |
Domain d4pj0e_: 4pj0 E: [260541] Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0k_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_, d4pj0z_ automated match to d2axte1 complexed with bcr, bct, cl, cla, dgd, fe, hec, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl has additional insertions and/or extensions that are not grouped together |
PDB Entry: 4pj0 (more details), 2.44 Å
SCOPe Domain Sequences for d4pj0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj0e_ f.23.38.1 (E:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus elongatus [TaxId: 146786]} agttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqr siplvtdrfeakqqvetfleql
Timeline for d4pj0e_: