![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) ![]() automatically mapped to Pfam PF02419 |
![]() | Family f.23.31.1: PsbL-like [161018] (2 proteins) Pfam PF02419 |
![]() | Protein Photosystem II reaction center protein L, PsbL [161019] (2 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:146786] [161020] (6 PDB entries) Uniprot Q8DIN8 1-37 |
![]() | Domain d4pj0l_: 4pj0 L: [260552] Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0k_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_, d4pj0z_ automated match to d2axtl1 complexed with bcr, bct, cl, cla, dgd, fe, hec, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl |
PDB Entry: 4pj0 (more details), 2.44 Å
SCOPe Domain Sequences for d4pj0l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj0l_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus elongatus [TaxId: 146786]} epnpnrqpvelnrtslylglllilvlallfssyffn
Timeline for d4pj0l_: