| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
| Protein automated matches [190224] (17 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:197221] [260543] (10 PDB entries) |
| Domain d4pj0a_: 4pj0 A: [260548] Other proteins in same PDB: d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0k_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_, d4pj0z_ automated match to d2axta1 complexed with bcr, bct, cl, cla, dgd, fe, hec, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl |
PDB Entry: 4pj0 (more details), 2.44 Å
SCOPe Domain Sequences for d4pj0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj0a_ f.26.1.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
nlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgsl
lygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrqw
elsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaehn
ilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetynivaa
hgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvidakg
nvintwadiinranlgmevmhernahnfpldla
Timeline for d4pj0a_: