![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.2: PsbU-like [158539] (2 proteins) Pfam PF06514 |
![]() | Protein automated matches [191005] (3 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [260559] (5 PDB entries) |
![]() | Domain d4pj0u_: 4pj0 U: [260560] Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0k_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0v_, d4pj0x_, d4pj0z_ automated match to d2axtu1 complexed with bcr, bct, cl, cla, dgd, fe, hec, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl |
PDB Entry: 4pj0 (more details), 2.44 Å
SCOPe Domain Sequences for d4pj0u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj0u_ a.60.12.2 (U:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} lvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipglt erqkqilrenlehftvtevetalveggdrynnglyk
Timeline for d4pj0u_: