Lineage for d4pj0o_ (4pj0 O:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3021956Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 3021998Family f.4.1.4: PsbO-like [161115] (2 proteins)
    Pfam PF01716; MSP
  6. 3022031Protein automated matches [191004] (2 species)
    not a true protein
  7. 3022032Species Thermosynechococcus elongatus [TaxId:197221] [260553] (5 PDB entries)
  8. 3022034Domain d4pj0o_: 4pj0 O: [260554]
    Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0k_, d4pj0l_, d4pj0m_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_, d4pj0z_
    automated match to d4il6o_
    complexed with bcr, bct, cl, cla, dgd, fe, hec, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl

Details for d4pj0o_

PDB Entry: 4pj0 (more details), 2.44 Å

PDB Description: structure of t.elongatus photosystem ii, rows of dimers crystal packing
PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d4pj0o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj0o_ f.4.1.4 (O:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
ep

SCOPe Domain Coordinates for d4pj0o_:

Click to download the PDB-style file with coordinates for d4pj0o_.
(The format of our PDB-style files is described here.)

Timeline for d4pj0o_: