Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) automatically mapped to Pfam PF00421 |
Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
Protein automated matches [191285] (5 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [260540] (5 PDB entries) |
Domain d4pj0c_: 4pj0 C: [260544] Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0k_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_, d4pj0z_ automated match to d3arcc_ complexed with bcr, bct, cl, cla, dgd, fe, hec, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl |
PDB Entry: 4pj0 (more details), 2.44 Å
SCOPe Domain Sequences for d4pj0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj0c_ f.55.1.1 (C:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} rdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqg liliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyss ffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptld prvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafi wsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklg anvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiq pwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwha graraaaagfekgidresepvlsmpsld
Timeline for d4pj0c_: