Lineage for d2iamd2 (2iam D:113-240)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751164Domain d2iamd2: 2iam D:113-240 [198043]
    Other proteins in same PDB: d2iama1, d2iama2, d2iamb1, d2iamb2, d2iamc1, d2iamd1
    automated match to d1qsee2
    mutant

Details for d2iamd2

PDB Entry: 2iam (more details), 2.8 Å

PDB Description: structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
PDB Compounds: (D:) CD4+ T cell receptor E8 beta chain

SCOPe Domain Sequences for d2iamd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iamd2 b.1.1.2 (D:113-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

SCOPe Domain Coordinates for d2iamd2:

Click to download the PDB-style file with coordinates for d2iamd2.
(The format of our PDB-style files is described here.)

Timeline for d2iamd2: