![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (12 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries) |
![]() | Domain d2iamd2: 2iam D:113-240 [198043] Other proteins in same PDB: d2iama1, d2iama2, d2iamb1, d2iamb2, d2iamc1, d2iamd1 automated match to d1qsee2 mutant |
PDB Entry: 2iam (more details), 2.8 Å
SCOPe Domain Sequences for d2iamd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iamd2 b.1.1.2 (D:113-240) automated matches {Human (Homo sapiens) [TaxId: 9606]} lnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs aeawgrad
Timeline for d2iamd2: