Lineage for d2iamc1 (2iam C:1-109)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296597Domain d2iamc1: 2iam C:1-109 [198040]
    Other proteins in same PDB: d2iama1, d2iama2, d2iamb1, d2iamb2, d2iamc2, d2iamd2
    automated match to d1qrnd1
    mutant

Details for d2iamc1

PDB Entry: 2iam (more details), 2.8 Å

PDB Description: structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
PDB Compounds: (C:) CD4+ T cell receptor E8 alpha chain

SCOPe Domain Sequences for d2iamc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iamc1 b.1.1.0 (C:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
ttvaterysllyisssqttdsgvyfcaaliqgaqklvfgqgtrltinpn

SCOPe Domain Coordinates for d2iamc1:

Click to download the PDB-style file with coordinates for d2iamc1.
(The format of our PDB-style files is described here.)

Timeline for d2iamc1: