SCOPe 2.04: Domain d2iamd2: 2iam D:113-240

Lineage for d2iamd2 (2iam D:113-240)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d2iamd2: 2iam D:113-240 [198043]
   Other proteins in same PDB: d2iama1, d2iama2, d2iamb1, d2iamb2, d2iamc1, d2iamd1
   automated match to d1qsee2
   mutant

Details for d2iamd2

PDB Entry: 2iam, 2.8 Å

PDB Description: structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr

PDB Compounds: (D:) CD4+ T cell receptor E8 beta chain

SCOPe Domain Sequences for d2iamd2:

Sequence; same for both SEQRES and ATOM records:

>d2iamd2 b.1.1.2 (D:113-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

Timeline for d2iamd2:

• d2iamd2 first appeared in SCOPe 2.03
  
• d2iamd2 appears in SCOPe 2.05
  
• d2iamd2 appears in the current release, SCOPe 2.08