Lineage for d1qsee2 (1qse E:119-246)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein T-cell antigen receptor [49125] (7 species) 
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries) 
Domain d1qsee2: 1qse E:119-246 [21577]
Other proteins in same PDB: d1qsea1, d1qsea2, d1qseb_, d1qsed1, d1qsee1
Details for d1qsee2
PDB Entry: 1qse (more details), 2.8 Å
PDB Description: structure of human a6-tcr bound to hla-a2 complexed with altered htlv- 1 tax peptide v7r
PDB Compounds: (E:) PROTEIN (hman T-Cell receptor)SCOPe Domain Sequences for d1qsee2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsee2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad
SCOPe Domain Coordinates for d1qsee2:
Click to download the PDB-style file with coordinates for d1qsee2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qsee2:
- d1qsee2 first appeared (with stable ids) in SCOP 1.55
- d1qsee2 appears in SCOPe 2.03
- d1qsee2 appears in SCOPe 2.05
- d1qsee2 appears in the current release, SCOPe 2.08
View in 3D
