Lineage for d2iamd1 (2iam D:2-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756992Domain d2iamd1: 2iam D:2-112 [198042]
    Other proteins in same PDB: d2iama1, d2iama2, d2iamb1, d2iamb2, d2iamc2, d2iamd2
    automated match to d1qrne1
    mutant

Details for d2iamd1

PDB Entry: 2iam (more details), 2.8 Å

PDB Description: structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
PDB Compounds: (D:) CD4+ T cell receptor E8 beta chain

SCOPe Domain Sequences for d2iamd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iamd1 b.1.1.0 (D:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfrilkigqsmtlqctqdmnhnymywyrqdpgmglkliyysvgagitdkgevp
ngynvsrsttedfplrlelaapsqtsvyfcastyhgtgyfgegswltvved

SCOPe Domain Coordinates for d2iamd1:

Click to download the PDB-style file with coordinates for d2iamd1.
(The format of our PDB-style files is described here.)

Timeline for d2iamd1: