SCOPe 2.08: Domain d2iamd1: 2iam D:2-112

Lineage for d2iamd1 (2iam D:2-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2iamd1: 2iam D:2-112 [198042]
   Other proteins in same PDB: d2iama1, d2iama2, d2iamb1, d2iamb2, d2iamc2, d2iamd2
   automated match to d1qrne1
   mutant

Details for d2iamd1

PDB Entry: 2iam, 2.8 Å

PDB Description: structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr

PDB Compounds: (D:) CD4+ T cell receptor E8 beta chain

SCOPe Domain Sequences for d2iamd1:

Sequence; same for both SEQRES and ATOM records:

>d2iamd1 b.1.1.0 (D:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfrilkigqsmtlqctqdmnhnymywyrqdpgmglkliyysvgagitdkgevp
ngynvsrsttedfplrlelaapsqtsvyfcastyhgtgyfgegswltvved

Timeline for d2iamd1:

• d2iamd1 first appeared in SCOPe 2.03
  
• d2iamd1 appears in SCOPe 2.07