![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family) ![]() |
![]() | Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
![]() | Protein automated matches [191002] (2 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:32046] [188747] (2 PDB entries) |
![]() | Domain d3bz2j_: 3bz2 J: [172958] Other proteins in same PDB: d3bz2a_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2k_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2u_, d3bz2v_, d3bz2z_ automated match to d2axtj1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd |
PDB Entry: 3bz2 (more details), 2.9 Å
SCOPe Domain Sequences for d3bz2j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz2j_ f.23.32.1 (J:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]} riplwivatvagmgvivivglffygayaglgssl
Timeline for d3bz2j_: