Lineage for d3bz2j_ (3bz2 J:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238784Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family) (S)
  5. 1238785Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 1238789Protein automated matches [191002] (2 species)
    not a true protein
  7. 1238790Species Thermosynechococcus elongatus [TaxId:32046] [188747] (2 PDB entries)
  8. 1238791Domain d3bz2j_: 3bz2 J: [172958]
    Other proteins in same PDB: d3bz2a_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2k_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2u_, d3bz2v_, d3bz2z_
    automated match to d2axtj1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2j_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d3bz2j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2j_ f.23.32.1 (J:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
riplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d3bz2j_:

Click to download the PDB-style file with coordinates for d3bz2j_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2j_: