PDB entry 3bz2

View 3bz2 on RCSB PDB site
Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
Class: electron transport
Keywords: ELECTRON TRANSPORT photosystem, ps ii, ps2, membrane complex, transmembrane alpha-helix, Herbicide resistance, Iron, Metal-binding, Photosynthesis, Photosystem II, Thylakoid, Heme, Reaction center, Manganese, ELECTRON TRANSPORT
Deposited on 2008-01-17, released 2009-01-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.249
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photosystem Q(B) protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3bz2a_
  • Chain 'B':
    Compound: Photosystem II core light harvesting protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Photosystem II CP43 protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Photosystem II reaction center D2 protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3bz2d_
  • Chain 'E':
    Compound: Cytochrome b559 subunit alpha
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3bz2e_
  • Chain 'F':
    Compound: Cytochrome b559 subunit beta
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3bz2f_
  • Chain 'H':
    Compound: Photosystem II reaction center protein H
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3bz2h_
  • Chain 'I':
    Compound: Photosystem II reaction center protein I
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Photosystem II reaction center protein J
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3bz2j_
  • Chain 'K':
    Compound: Photosystem II reaction center protein K
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3bz2k_
  • Chain 'L':
    Compound: Photosystem II reaction center protein L
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3bz2l_
  • Chain 'M':
    Compound: Photosystem II reaction center protein M
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3bz2m_
  • Chain 'O':
    Compound: Photosystem II manganese-stabilizing polypeptide
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3bz2o_
  • Chain 'T':
    Compound: Photosystem II reaction center protein T
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Photosystem II 12 kDa extrinsic protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3bz2u_
  • Chain 'V':
    Compound: cytochrome c-550
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3bz2v_
  • Chain 'X':
    Compound: Photosystem II PsbX protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Photosystem II protein Y
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BZ2 (0-27)
  • Chain 'Z':
    Compound: Photosystem II reaction center protein Z
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3bz2z_
  • Chain 'y':
    Compound: Protein ycf12
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, FE2, BCT, CLA, PHO, HEM, PL9, OEC, BCR, DGD, LHG, SQD, LMG, LMT, CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bz2A (A:)
    mtttlqrresanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdi
    dgirepvsgsllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfl
    lgascymgrqwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtf
    nfmivfqaehnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfg
    qeeetynivaahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngf
    nfnhsvidakgnvintwadiinranlgmevmhernahnfpldla
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bz2A (A:)
    sanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsg
    sllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgr
    qwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqae
    hnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniv
    aahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvida
    kgnvintwadiinranlgmevmhernahnfpldla
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bz2D (D:)
    mtiaigrapaergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswyt
    hglassylegcnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgaf
    gligfmlrqfeiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifr
    fllffqgfhnwtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqa
    eetysmvtanrfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfis
    qeiraaedpefetfytknlllnegirawmapqdqphenfvfpeevlprgnal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bz2D (D:)
    gwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegcn
    fltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfei
    arlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnwt
    lnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanrf
    wsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpefe
    tfytknlllnegirawmapqdqphenfvfpeevlprgnal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3bz2E (E:)
    magttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeq
    rsiplvtdrfeakqqvetfleqlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bz2E (E:)
    gttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrs
    iplvtdrfeakqqvetfleqlk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3bz2F (F:)
    mtsntpnqepvsypiftvrwvavhtlavptifflgaiaamqfiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bz2F (F:)
    vsypiftvrwvavhtlavptifflgaiaamqfiqr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3bz2H (H:)
    marrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnv
    swkalg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bz2H (H:)
    arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
    wkalg
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3bz2J (J:)
    mmseggriplwivatvagmgvivivglffygayaglgssl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bz2J (J:)
    riplwivatvagmgvivivglffygayaglgssl
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bz2K (K:)
    klpeayaifdplvdvlpvipvlflalafvwqaavgfr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bz2L (L:)
    mepnpnrqpvelnrtslylglllilvlallfssyffn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3bz2M (M:)
    mevnqlgliatalfvlvpsvfliilyvqtesqqkss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bz2M (M:)
    mevnqlgliatalfvlvpsvfliilyvqtesqqk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3bz2O (O:)
    aakqtltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknk
    rqeaefvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripll
    ftvknlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqake
    eelaranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvf
    yasiepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bz2O (O:)
    tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
    efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
    nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
    ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
    epa
    

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3bz2U (U:)
    atasteeelvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesved
    vlnipglterqkqilrenlehftvtevetalveggdrynnglyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bz2U (U:)
    elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
    terqkqilrenlehftvtevetalveggdrynnglyk
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bz2V (V:)
    aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
    latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
    vepkilgdkwgggkvyy
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bz2Z (Z:)
    mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
    vv
    

  • Chain 'y':
    No sequence available.