Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (1 family) |
Family f.23.36.1: PsbK-like [161038] (1 protein) Pfam PF02533 |
Protein Photosystem II reaction center protein K, PsbK [161039] (2 species) |
Species Thermosynechococcus elongatus [TaxId:146786] [161040] (3 PDB entries) Uniprot Q9F1K9 10-46 |
Domain d3bz2k_: 3bz2 K: [191702] Other proteins in same PDB: d3bz2a_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2j_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2u_, d3bz2v_, d3bz2z_ automated match to d2axtk1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd |
PDB Entry: 3bz2 (more details), 2.9 Å
SCOPe Domain Sequences for d3bz2k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz2k_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus elongatus [TaxId: 146786]} klpeayaifdplvdvlpvipvlflalafvwqaavgfr
Timeline for d3bz2k_: