Lineage for d3bz2k_ (3bz2 K:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238825Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (1 family) (S)
  5. 1238826Family f.23.36.1: PsbK-like [161038] (1 protein)
    Pfam PF02533
  6. 1238827Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)
  7. 1238828Species Thermosynechococcus elongatus [TaxId:146786] [161040] (3 PDB entries)
    Uniprot Q9F1K9 10-46
  8. 1238829Domain d3bz2k_: 3bz2 K: [191702]
    Other proteins in same PDB: d3bz2a_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2j_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2u_, d3bz2v_, d3bz2z_
    automated match to d2axtk1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2k_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d3bz2k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2k_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus elongatus [TaxId: 146786]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d3bz2k_:

Click to download the PDB-style file with coordinates for d3bz2k_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2k_: