Lineage for d3bz2o_ (3bz2 O:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1236764Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 1236765Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 1236796Family f.4.1.4: PsbO-like [161115] (2 proteins)
    Pfam PF01716; MSP
  6. 1236803Protein automated matches [191004] (1 species)
    not a true protein
  7. 1236804Species Thermosynechococcus elongatus [TaxId:32046] [188749] (2 PDB entries)
  8. 1236805Domain d3bz2o_: 3bz2 O: [172961]
    Other proteins in same PDB: d3bz2a_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2j_, d3bz2k_, d3bz2l_, d3bz2m_, d3bz2u_, d3bz2v_, d3bz2z_
    automated match to d2axto1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2o_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d3bz2o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2o_ f.4.1.4 (O:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
epa

SCOPe Domain Coordinates for d3bz2o_:

Click to download the PDB-style file with coordinates for d3bz2o_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2o_: