Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) |
Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
Protein automated matches [191000] (2 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:32046] [188745] (2 PDB entries) |
Domain d3bz2f_: 3bz2 F: [172956] Other proteins in same PDB: d3bz2a_, d3bz2d_, d3bz2h_, d3bz2j_, d3bz2k_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2u_, d3bz2v_, d3bz2z_ automated match to d2axtf1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd |
PDB Entry: 3bz2 (more details), 2.9 Å
SCOPe Domain Sequences for d3bz2f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz2f_ f.23.38.1 (F:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]} vsypiftvrwvavhtlavptifflgaiaamqfiqr
Timeline for d3bz2f_: