Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (4 families) |
Family b.40.6.0: automated matches [254223] (1 protein) not a true family |
Protein automated matches [254506] (3 species) not a true protein |
Domain d3d31b1: 3d31 B:230-348 [157263] Other proteins in same PDB: d3d31a1, d3d31a2, d3d31b2, d3d31c1, d3d31d1 automated match to d3d31a1 complexed with wo4 |
PDB Entry: 3d31 (more details), 3 Å
SCOPe Domain Sequences for d3d31b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d31b1 b.40.6.0 (B:230-348) automated matches {Methanosarcina acetivorans [TaxId: 2214]} fenvlkgrvisaeqgllrirvgevvidaagdmevgdqvyaflrpenialsksstqssirn slqgrvteawvlgalvrvkvdcgvplnvlitrrsaeemelspgvqiyarfkassvhvlr
Timeline for d3d31b1:
View in 3D Domains from other chains: (mouse over for more information) d3d31a1, d3d31a2, d3d31c1, d3d31d1 |