SCOPe 2.08: Domain d3d31b2: 3d31 B:1-229

Lineage for d3d31b2 (3d31 B:1-229)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein automated matches [190723] (8 species)
   not a true protein

7. Species Methanosarcina acetivorans [TaxId:2214] [255793] (1 PDB entry)

8. Domain d3d31b2: 3d31 B:1-229 [157264]
   Other proteins in same PDB: d3d31a1, d3d31a2, d3d31b1, d3d31c1, d3d31d1
   automated match to d3d31a2
   complexed with wo4

Details for d3d31b2

PDB Entry: 3d31, 3 Å

PDB Description: modbc from methanosarcina acetivorans

PDB Compounds: (B:) Sulfate/molybdate ABC transporter, ATP-binding protein

SCOPe Domain Sequences for d3d31b2:

Sequence; same for both SEQRES and ATOM records:

>d3d31b2 c.37.1.12 (B:1-229) automated matches {Methanosarcina acetivorans [TaxId: 2214]}
mieieslsrkwknfsldnlslkvesgeyfvilgptgagktlfleliagfhvpdsgrilld
gkdvtdlspekhdiafvyqnyslfphmnvkknlefgmrmkkikdpkrvldtardlkiehl
ldrnpltlsggeqqrvalaralvtnpkillldeplsaldprtqenaremlsvlhkknklt
vlhithdqtearimadriavvmdgkliqvgkpeeifekpvegrvasfvg

Timeline for d3d31b2:

• d3d31b2 first appeared in SCOP 1.75
  
• d3d31b2 appears in SCOPe 2.07