![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.58: MetI-like [161097] (1 superfamily) core: 5 transmembrane helices; flattened bundle |
![]() | Superfamily f.58.1: MetI-like [161098] (1 family) ![]() |
![]() | Family f.58.1.1: MetI-like [161099] (6 proteins) Pfam PF00528; Binding-protein-dependent transport system inner membrane component |
![]() | Protein Sulfate/molybdate ABC transporter, permease protein [161100] (1 species) |
![]() | Species Methanosarcina acetivorans [TaxId:2214] [161101] (1 PDB entry) Uniprot Q8TTZ4 13-260 |
![]() | Domain d3d31c1: 3d31 C:13-260 [157265] Other proteins in same PDB: d3d31a1, d3d31a2, d3d31b1, d3d31b2 complexed with wo4 |
PDB Entry: 3d31 (more details), 3 Å
SCOPe Domain Sequences for d3d31c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d31c1 f.58.1.1 (C:13-260) Sulfate/molybdate ABC transporter, permease protein {Methanosarcina acetivorans [TaxId: 2214]} pltfvfsflllvlflfifltlsnmifeqitedfsglvkaagnrsvissiflslyagflat llalllgaptgyilarfdfpgkrlvesiidvpvvvphtvagialltvfgsrgligeples yiqfrdalpgivvamlfvsmpylansaregfksvdprlenaarslgaplwkafffvtlpl sarylligsvmtwaraisefgavvilayypmvgptliydrfisyglsasrpiavllilvt lsiflvir
Timeline for d3d31c1: