Lineage for d3d31d1 (3d31 D:13-260)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029031Fold f.58: MetI-like [161097] (1 superfamily)
    core: 5 transmembrane helices; flattened bundle
  4. 3029032Superfamily f.58.1: MetI-like [161098] (1 family) (S)
  5. 3029033Family f.58.1.1: MetI-like [161099] (6 proteins)
    Pfam PF00528; Binding-protein-dependent transport system inner membrane component
  6. 3029066Protein Sulfate/molybdate ABC transporter, permease protein [161100] (1 species)
  7. 3029067Species Methanosarcina acetivorans [TaxId:2214] [161101] (1 PDB entry)
    Uniprot Q8TTZ4 13-260
  8. 3029069Domain d3d31d1: 3d31 D:13-260 [157266]
    Other proteins in same PDB: d3d31a1, d3d31a2, d3d31b1, d3d31b2
    automatically matched to 3D31 C:13-260
    complexed with wo4

Details for d3d31d1

PDB Entry: 3d31 (more details), 3 Å

PDB Description: modbc from methanosarcina acetivorans
PDB Compounds: (D:) Sulfate/molybdate ABC transporter, permease protein

SCOPe Domain Sequences for d3d31d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d31d1 f.58.1.1 (D:13-260) Sulfate/molybdate ABC transporter, permease protein {Methanosarcina acetivorans [TaxId: 2214]}
pltfvfsflllvlflfifltlsnmifeqitedfsglvkaagnrsvissiflslyagflat
llalllgaptgyilarfdfpgkrlvesiidvpvvvphtvagialltvfgsrgligeples
yiqfrdalpgivvamlfvsmpylansaregfksvdprlenaarslgaplwkafffvtlpl
sarylligsvmtwaraisefgavvilayypmvgptliydrfisyglsasrpiavllilvt
lsiflvir

SCOPe Domain Coordinates for d3d31d1:

Click to download the PDB-style file with coordinates for d3d31d1.
(The format of our PDB-style files is described here.)

Timeline for d3d31d1: