Lineage for d3cxhn1 (3cxh N:262-385)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027980Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 3027981Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 3028050Family f.32.1.0: automated matches [254197] (1 protein)
    not a true family
  6. 3028051Protein automated matches [254431] (4 species)
    not a true protein
  7. 3028069Species Saccharomyces cerevisiae [TaxId:764097] [255786] (2 PDB entries)
  8. 3028073Domain d3cxhn1: 3cxh N:262-385 [157129]
    Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf_, d3cxhg_, d3cxhh_, d3cxhi_, d3cxhj_, d3cxhk_, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq_, d3cxhr_, d3cxhs_, d3cxht_, d3cxhu_, d3cxhv_, d3cxhw_
    automated match to d1kb9c1
    complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, sma, umq

Details for d3cxhn1

PDB Entry: 3cxh (more details), 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
PDB Compounds: (N:) cytochrome b

SCOPe Domain Sequences for d3cxhn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cxhn1 f.32.1.0 (N:262-385) automated matches {Saccharomyces cerevisiae [TaxId: 764097]}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk

SCOPe Domain Coordinates for d3cxhn1:

Click to download the PDB-style file with coordinates for d3cxhn1.
(The format of our PDB-style files is described here.)

Timeline for d3cxhn1: