Details for d3cxhd2

PDB Entry: 3cxh (more details), 2.5 Å

PDB Description: Structure of yeast complex III with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d3cxhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cxhd2 f.23.11.1 (D:261-307) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppkp

SCOPe Domain Coordinates for d3cxhd2:

Click to download the PDB-style file with coordinates for d3cxhd2.
(The format of our PDB-style files is described here.)

Timeline for d3cxhd2: