Lineage for d3cxho1 (3cxh O:62-260)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691442Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 2691443Protein Cytochrome bc1 domain [46677] (4 species)
  7. 2691444Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63462] (7 PDB entries)
  8. 2691451Domain d3cxho1: 3cxh O:62-260 [157131]
    Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf_, d3cxhg_, d3cxhh_, d3cxhi_, d3cxhj_, d3cxhk_, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq_, d3cxhr_, d3cxhs_, d3cxht_, d3cxhu_, d3cxhv_, d3cxhw_
    automated match to d1kyod1
    complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, sma, umq

Details for d3cxho1

PDB Entry: 3cxh (more details), 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
PDB Compounds: (O:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d3cxho1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cxho1 a.3.1.3 (O:62-260) Cytochrome bc1 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
attsqmakdvttflnwcae

SCOPe Domain Coordinates for d3cxho1:

Click to download the PDB-style file with coordinates for d3cxho1.
(The format of our PDB-style files is described here.)

Timeline for d3cxho1: