SCOPe 2.08: Domain d3cxhs_: 3cxh S:

Lineage for d3cxhs_ (3cxh S:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)
   automatically mapped to Pfam PF02939

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81505] (10 PDB entries)

8. Domain d3cxhs_: 3cxh S: [157137]
   Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf_, d3cxhg_, d3cxhi_, d3cxhj_, d3cxhk_, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq_, d3cxhr_, d3cxht_, d3cxhu_, d3cxhv_, d3cxhw_
   automated match to d1ezvg_
   complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, sma, umq

Details for d3cxhs_

PDB Entry: 3cxh, 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.

PDB Compounds: (S:) Cytochrome b-c1 complex subunit 8

SCOPe Domain Sequences for d3cxhs_:

Sequence; same for both SEQRES and ATOM records:

>d3cxhs_ f.23.13.1 (S:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
pagiywywwkngneyneflyskagreelervnv

Timeline for d3cxhs_:

• d3cxhs_ first appeared in SCOP 1.75, called d3cxhs1
  
• d3cxhs_ appears in SCOPe 2.07