Lineage for d3cxhl2 (3cxh L:240-457)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005156Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 3005157Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 3005158Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 3005159Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 3005160Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64304] (7 PDB entries)
  8. 3005174Domain d3cxhl2: 3cxh L:240-457 [157126]
    Other proteins in same PDB: d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf_, d3cxhg_, d3cxhh_, d3cxhi_, d3cxhj_, d3cxhk_, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq_, d3cxhr_, d3cxhs_, d3cxht_, d3cxhu_, d3cxhv_, d3cxhw_
    automated match to d1kb9a2
    complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, sma, umq

Details for d3cxhl2

PDB Entry: 3cxh (more details), 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
PDB Compounds: (L:) Cytochrome b-c1 complex subunit 1, mitochondrial

SCOPe Domain Sequences for d3cxhl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cxhl2 d.185.1.1 (L:240-457) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kkaaflgsevrlrddtlpkawislavegepvnspnyfvaklaaqifgsynafepasrlqg
iklldniqeyqlcdnfnhfslsykdsglwgfstatrnvtmiddlihftlkqwnrltisvt
dteveraksllklqlgqlyesgnpvndanllgaevlikgsklslgeafkkidaitvkdvk
awagkrlwdqdiaiagtgqieglldymrirsdmsmmrw

SCOPe Domain Coordinates for d3cxhl2:

Click to download the PDB-style file with coordinates for d3cxhl2.
(The format of our PDB-style files is described here.)

Timeline for d3cxhl2: