SCOPe 2.08: Domain d3cxhw_: 3cxh W:

Lineage for d3cxhw_ (3cxh W:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (92 PDB entries)
   Uniprot P00044

8. Domain d3cxhw_: 3cxh W: [161631]
   Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf_, d3cxhg_, d3cxhh_, d3cxhi_, d3cxhj_, d3cxhk_, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq_, d3cxhr_, d3cxhs_, d3cxht_, d3cxhu_, d3cxhv_
   automated match to d1yeaa_
   complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, sma, umq

Details for d3cxhw_

PDB Entry: 3cxh, 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.

PDB Compounds: (W:) Cytochrome c iso-2

SCOPe Domain Sequences for d3cxhw_:

Sequence; same for both SEQRES and ATOM records:

>d3cxhw_ a.3.1.1 (W:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
akestgfkpgsakkgatlfktrcqqchtieeggpnkvgpnlhgifgrhsgqvkgysytda
ninknvkwdedsmseyltnpkkyipgtkmafaglkkekdrndlitymtkaak

Timeline for d3cxhw_:

• d3cxhw_ first appeared in SCOPe 2.01
  
• d3cxhw_ appears in SCOPe 2.07