Lineage for d2avyl1 (2avy L:1-123)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789950Protein Ribosomal protein S12 [50302] (2 species)
  7. 2789951Species Escherichia coli [TaxId:562] [159087] (25 PDB entries)
    Uniprot P0A7S3 1-123
  8. 2789964Domain d2avyl1: 2avy L:1-123 [144853]
    Other proteins in same PDB: d2avyb1, d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyh1, d2avyi1, d2avyj1, d2avyk1, d2avym1, d2avyn1, d2avyo1, d2avyp1, d2avyq1, d2avyr1, d2avys1, d2avyt1, d2avyu1
    Representative structure
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2avyl1

PDB Entry: 2avy (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d2avyl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avyl1 b.40.4.5 (L:1-123) Ribosomal protein S12 {Escherichia coli [TaxId: 562]}
atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
pka

SCOPe Domain Coordinates for d2avyl1:

Click to download the PDB-style file with coordinates for d2avyl1.
(The format of our PDB-style files is described here.)

Timeline for d2avyl1: