![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
![]() | Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) ![]() automatically mapped to Pfam PF00410 |
![]() | Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
![]() | Protein Ribosomal protein S8 [56049] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [111186] (9 PDB entries) Uniprot P02361 |
![]() | Domain d2avyh1: 2avy H:3-129 [127387] Other proteins in same PDB: d2avyb1, d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyi1, d2avyj1, d2avyk1, d2avyl1, d2avym1, d2avyn1, d2avyo1, d2avyp1, d2avyq1, d2avyr1, d2avys1, d2avyt1, d2avyu1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2avy (more details), 3.46 Å
SCOPe Domain Sequences for d2avyh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2avyh1 d.140.1.1 (H:3-129) Ribosomal protein S8 {Escherichia coli [TaxId: 562]} qdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltl kyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgg eiicyva
Timeline for d2avyh1: