SCOPe 2.08: Domain d2avyn1: 2avy N:1-100

Lineage for d2avyn1 (2avy N:1-100)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (2 species)

7. Species Escherichia coli [TaxId:562] [161162] (24 PDB entries)
   Uniprot P02370 1-100

8. Domain d2avyn1: 2avy N:1-100 [144855]
   Other proteins in same PDB: d2avyb1, d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyh1, d2avyi1, d2avyj1, d2avyk1, d2avyl1, d2avym1, d2avyo1, d2avyp1, d2avyq1, d2avyr1, d2avys1, d2avyt1, d2avyu1
   Representative structure
   protein/RNA complex; complexed with mg
   protein/RNA complex; complexed with mg
   has additional insertions and/or extensions that are not grouped together

Details for d2avyn1

PDB Entry: 2avy, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2avyn1:

Sequence, based on SEQRES records:

>d2avyn1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr
nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw

Sequence, based on observed residues (ATOM records):

>d2avyn1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr
qtgrphgflrkfglsrikvreaamrgeipglkkasw

Timeline for d2avyn1:

• d2avyn1 first appeared in SCOP 1.75
  
• d2avyn1 appears in SCOPe 2.07