| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
| Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit automatically mapped to Pfam PF00312 |
| Protein Ribosomal protein S15 [47065] (3 species) |
| Species Escherichia coli [TaxId:562] [158383] (10 PDB entries) Uniprot Q8X9M2 2-89 |
| Domain d2avyo1: 2avy O:1-88 [144856] Other proteins in same PDB: d2avyb1, d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyh1, d2avyi1, d2avyj1, d2avyk1, d2avyl1, d2avym1, d2avyn1, d2avyp1, d2avyq1, d2avyr1, d2avys1, d2avyt1, d2avyu1 Representative structure protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2avy (more details), 3.46 Å
SCOPe Domain Sequences for d2avyo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2avyo1 a.16.1.2 (O:1-88) Ribosomal protein S15 {Escherichia coli [TaxId: 562]}
slsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvs
qrrklldylkrkdvarytrlierlglrr
Timeline for d2avyo1: