Lineage for d2avyh1 (2avy H:3-129)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734191Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 734192Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 734193Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 734194Protein Ribosomal protein S8 [56049] (4 species)
  7. 734201Species Escherichia coli [TaxId:562] [111186] (9 PDB entries)
  8. 734208Domain d2avyh1: 2avy H:3-129 [127387]
    automatically matched to d1s03h_
    complexed with mg

Details for d2avyh1

PDB Entry: 2avy (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOP Domain Sequences for d2avyh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avyh1 d.140.1.1 (H:3-129) Ribosomal protein S8 {Escherichia coli [TaxId: 562]}
qdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltl
kyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgg
eiicyva

SCOP Domain Coordinates for d2avyh1:

Click to download the PDB-style file with coordinates for d2avyh1.
(The format of our PDB-style files is described here.)

Timeline for d2avyh1: