SCOPe 2.08: Domain d1za3h1: 1za3 H:1-113

Lineage for d1za3h1 (1za3 H:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158863] (2 PDB entries)

8. Domain d1za3h1: 1za3 H:1-113 [124791]
   Other proteins in same PDB: d1za3a1, d1za3a2, d1za3b2, d1za3h2, d1za3l1, d1za3l2, d1za3r1, d1za3r2, d1za3r3, d1za3s1, d1za3s2, d1za3s3
   automatically matched to d1i3va_

Details for d1za3h1

PDB Entry: 1za3, 3.35 Å

PDB Description: The crystal structure of the YSd1 Fab bound to DR5

PDB Compounds: (H:) Fab-YSd1 heavy chain

SCOPe Domain Sequences for d1za3h1:

Sequence; same for both SEQRES and ATOM records:

>d1za3h1 b.1.1.1 (H:1-113) Camelid IG heavy chain variable domain, VHh {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfsiysysihwvrqapgkglewvasispysgytsy
adsvkgrftisadtskntaylqmnslraedtavyycsryssyysyyyssssysyamdywg
qgtlvtvss

Timeline for d1za3h1:

• d1za3h1 first appeared in SCOP 1.73
  
• d1za3h1 appears in SCOPe 2.07