Lineage for d1za3r1 (1za3 R:21-61)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034651Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 3034652Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 3034653Family g.24.1.1: TNF receptor-like [57587] (13 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 3034679Protein Death receptor-5 (dr5) fragment, N- and C-terminal domain [419060] (1 species)
  7. 3034680Species Human (Homo sapiens) [TaxId:9606] [419551] (5 PDB entries)
  8. 3034704Domain d1za3r1: 1za3 R:21-61 [124795]
    Other proteins in same PDB: d1za3a1, d1za3a2, d1za3b1, d1za3b2, d1za3h1, d1za3h2, d1za3l1, d1za3l2, d1za3r2, d1za3s2
    automatically matched to d1d0gr1
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1za3r1

PDB Entry: 1za3 (more details), 3.35 Å

PDB Description: The crystal structure of the YSd1 Fab bound to DR5
PDB Compounds: (R:) Tumor necrosis factor receptor superfamily member 10B

SCOPe Domain Sequences for d1za3r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1za3r1 g.24.1.1 (R:21-61) Death receptor-5 (dr5) fragment, N- and C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sspseglcppghhisedgrdcisckygqdysthwndllfcl

SCOPe Domain Coordinates for d1za3r1:

Click to download the PDB-style file with coordinates for d1za3r1.
(The format of our PDB-style files is described here.)

Timeline for d1za3r1: