Lineage for d1za3s2 (1za3 S:62-101)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034651Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 3034652Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 3034653Family g.24.1.1: TNF receptor-like [57587] (13 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. Protein Death receptor-5 (dr5) fragment, middle domain [419061] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [419552] (5 PDB entries)
  8. 3034678Domain d1za3s2: 1za3 S:62-101 [124799]
    Other proteins in same PDB: d1za3a1, d1za3a2, d1za3b1, d1za3b2, d1za3h1, d1za3h2, d1za3l1, d1za3l2, d1za3r1, d1za3r3, d1za3s1, d1za3s3
    automatically matched to d1d0gr2

Details for d1za3s2

PDB Entry: 1za3 (more details), 3.35 Å

PDB Description: The crystal structure of the YSd1 Fab bound to DR5
PDB Compounds: (S:) Tumor necrosis factor receptor superfamily member 10B

SCOPe Domain Sequences for d1za3s2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1za3s2 g.24.1.1 (S:62-101) Death receptor-5 (dr5) fragment, middle domain {Human (Homo sapiens) [TaxId: 9606]}
rctrcdsgevelspctttrntvcqceegtfreedspemcr

SCOPe Domain Coordinates for d1za3s2:

Click to download the PDB-style file with coordinates for d1za3s2.
(The format of our PDB-style files is described here.)

Timeline for d1za3s2: