Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [158863] (2 PDB entries) |
Domain d1za3b1: 1za3 B:1-113 [124789] Other proteins in same PDB: d1za3a1, d1za3a2, d1za3b2, d1za3h2, d1za3l1, d1za3l2, d1za3r1, d1za3r2, d1za3r3, d1za3s1, d1za3s2, d1za3s3 automatically matched to d1i3va_ |
PDB Entry: 1za3 (more details), 3.35 Å
SCOPe Domain Sequences for d1za3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1za3b1 b.1.1.1 (B:1-113) Camelid IG heavy chain variable domain, VHh {Human (Homo sapiens) [TaxId: 9606]} evqlvesggglvqpggslrlscaasgfsiysysihwvrqapgkglewvasispysgytsy adsvkgrftisadtskntaylqmnslraedtavyycsryssyysyyyssssysyamdywg qgtlvtvss
Timeline for d1za3b1: