SCOP 1.69: Domain d1ppjv_: 1ppj V:

Lineage for d1ppjv_ (1ppj V:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
   not a true fold

4. Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families)
   not a true superfamily

5. Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (1 protein)
   beta-hairpin and a short alpha-helix bound to the core subunits

6. Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [90079] (9 PDB entries)
   there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop

8. Domain d1ppjv_: 1ppj V: [104280]
   Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjc2, d1ppjd1, d1ppjd2, d1ppje1, d1ppje2, d1ppjf_, d1ppjg_, d1ppjh_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjp2, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjs_, d1ppjt_, d1ppju_, d1ppjw_

Details for d1ppjv_

PDB Entry: 1ppj, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin

SCOP Domain Sequences for d1ppjv_:

Sequence, based on SEQRES records:

>d1ppjv_ d.184.1.3 (V:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus)}
aavpatsespvldlklsvlcreslrgqaagrplvasvslnvpasvry

Sequence, based on observed residues (ATOM records):

>d1ppjv_ d.184.1.3 (V:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus)}
aavpatsespvlsvlcreslrgqaagrplvasvslnvpasvry

Timeline for d1ppjv_:

• d1ppjv_ is new in SCOP 1.69
  
• d1ppjv_ appears in SCOP 1.71
  
• d1ppjv_ appears in the current release, SCOPe 2.08